Your Position: Home > Recombinant Protein > Recombinant Escherichia coli DNA-binding protein HU-alpha(hupA)

Recombinant Escherichia coli DNA-binding protein HU-alpha(hupA)AP73906

Catalog No.	Package Size	Price
AP73906-1	10ug	$105.00
AP73906-2	50ug	$260.00
AP73906-3	100ug	$454.00
AP73906-4	200ug	$735.00
AP73906-5	500ug	$1240.00
AP73906-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Escherichia coli DNA-binding protein HU-alpha(hupA)
Brief Description Recombinant Protein
Host Species E.coli
Target Name hupA
Alternative Names HU-2 NS2
Accession No. Uniprot ID: P0ACF2
Target Species Escherichia coli O157:H7
SDS-PAGE MW 25.53kDa
Target Length Full Length,1-90aa
Tag Info N-terminal 6xHis-SUMO-tagged
Target Sequence MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 94.2% as determined by SDS-PAGE.

Images

Background

Histone-like DNA-binding protein which is capable of wrapping DNA to stabilize it, and thus to prevent its denaturation under extreme environmental conditions.

Regerences

"Genome sequence of enterohaemorrhagic Escherichia coli O157:H7."Perna N.T., Plunkett G. III, Burland V., Mau B., Glasner J.D., Rose D.J., Mayhew G.F., Evans P.S., Gregor J., Kirkpatrick H.A., Posfai G., Hackett J., Klink S., Boutin A., Shao Y., Miller L., Grotbeck E.J., Davis N.W. Blattner F.R.Nature 409:529-533(2001)

Published Papers

let us know

Customer Reviews and Rankings

No comment