Your Position: Home > Recombinant Protein > Recombinant Bacillus pumilus Cell division protein ZapA(zapA)

Recombinant Bacillus pumilus Cell division protein ZapA(zapA)AP73901

Catalog No.	Package Size	Price
AP73901-1	10ug	$105.00
AP73901-2	50ug	$260.00
AP73901-3	100ug	$454.00
AP73901-4	200ug	$735.00
AP73901-5	500ug	$1240.00
AP73901-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Bacillus pumilus Cell division protein ZapA(zapA)
Brief Description Recombinant Protein
Host Species E.coli
Target Name zapA
Alternative Names Z ring-associated protein ZapA
Accession No. Uniprot ID: A8FG14
Target Species Bacillus pumilus (strain SAFR-032)
SDS-PAGE MW 25.88kDa
Target Length Full Length,1-85aa
Tag Info N-terminal 6xHis-SUMO-tagged
Target Sequence MSDGGKTKTTVEIYGQSYTIIGQETKMHMRHVASIVDDKMREINEKNPYLDINKLAVLTAVNVVHDYLKLKEQYEKLEIQLKEKE
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

Activator of cell division through the inhibition of FtsZ GTPase activity, therefore promoting FtsZ assembly into bundles of protofilaments necessary for the formation of the division Z ring. It is recruited early at mid-cell but it is not essential for cell division.

Regerences

"Paradoxical DNA repair and peroxide resistance gene conservation in Bacillus pumilus SAFR-032."Gioia J., Yerrapragada S., Qin X., Jiang H., Igboeli O.C., Muzny D., Dugan-Rocha S., Ding Y., Hawes A., Liu W., Perez L., Kovar C., Dinh H., Lee S., Nazareth L., Blyth P., Holder M., Buhay C. Weinstock G.M.PLoS ONE 2:E928-E928(2007)

Published Papers

let us know

Customer Reviews and Rankings

No comment