Your Position: Home > Recombinant Protein > Recombinant Laribacter hongkongensis Orotate phosphoribosyltransferase(pyrE)

Recombinant Laribacter hongkongensis Orotate phosphoribosyltransferase(pyrE)AP73898

Catalog No.	Package Size	Price
AP73898-1	10ug	$105.00
AP73898-2	50ug	$260.00
AP73898-3	100ug	$454.00
AP73898-4	200ug	$735.00
AP73898-5	500ug	$1240.00
AP73898-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Laribacter hongkongensis Orotate phosphoribosyltransferase(pyrE)
Brief Description Recombinant Protein
Host Species E.coli
Target Name pyrE
Alternative Names Short name:OPRT Short name:OPRTase
Accession No. Uniprot ID: C1D6F5
Target Species Laribacter hongkongensis (strain HLHK9)
SDS-PAGE MW 38.91kDa
Target Length Full Length,1-213aa
Tag Info N-terminal 6xHis-SUMO-tagged
Target Sequence MSDFRQDFIRFAVEEQVLRFGEFVTKAGRPSPYFFNAGLFNHGASLLSLARFYARSISESGIAFDMLFGPAYKGIVLAGATAMMLAEQGRDVPFAFNRKEAKDHGEGGTLIGAPLKGRVLIIDDVISAGTSVRESVEIIRANGAEPAGVAIALDRMERGQGELSATQEVAQKFGLPVVAIASLDDLLGFLAGSPDLADNLTRVEAYRTQYGVR
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

Catalyzes the transfer of a ribosyl phosphate group from 5-phosphoribose 1-diphosphate to orotate, leading to the formation of orotidine monophosphate (OMP).

Regerences

"The complete genome and proteome of Laribacter hongkongensis reveal potential mechanisms for adaptations to different temperatures and habitats."Woo P.C.Y., Lau S.K.P., Tse H., Teng J.L.L., Curreem S.O., Tsang A.K.L., Fan R.Y.Y., Wong G.K.M., Huang Y., Loman N.J., Snyder L.A.S., Cai J.J., Huang J.-D., Mak W., Pallen M.J., Lok S., Yuen K.-Y.PLoS Genet. 5:E1000416-E1000416(2009)

Published Papers

let us know

Customer Reviews and Rankings

No comment