Your Position: Home > Recombinant Protein > Recombinant Staphylococcus aureus 50S ribosomal protein L7/L12(rplL)

Recombinant Staphylococcus aureus 50S ribosomal protein L7/L12(rplL)AP73895

Catalog No.	Package Size	Price
AP73895-1	10ug	$105.00
AP73895-2	50ug	$260.00
AP73895-3	100ug	$454.00
AP73895-4	200ug	$735.00
AP73895-5	500ug	$1240.00
AP73895-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Staphylococcus aureus 50S ribosomal protein L7/L12(rplL)
Brief Description Recombinant Protein
Host Species E.coli
Target Name rplL
Accession No. Uniprot ID: P66061
Target Species Staphylococcus aureus (strain Mu50 / ATCC 700699)
SDS-PAGE MW 28.7kDa
Target Length Full Length,1-122aa
Tag Info N-terminal 6xHis-SUMO-tagged
Target Sequence MANHEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAVAGAAGGADAAAEKTEFDVELTSAGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEEAEKLKEQLEEVGATVELK
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

Forms part of the ribosomal stalk which helps the ribosome interact with GTP-bound translation factors. Is thus essential for accurate translation.

Regerences

"Whole genome sequencing of meticillin-resistant Staphylococcus aureus."Kuroda M., Ohta T., Uchiyama I., Baba T., Yuzawa H., Kobayashi I., Cui L., Oguchi A., Aoki K., Nagai Y., Lian J.-Q., Ito T., Kanamori M., Matsumaru H., Maruyama A., Murakami H., Hosoyama A., Mizutani-Ui Y. Hiramatsu K.Lancet 357:1225-1240(2001)

Published Papers

let us know

Customer Reviews and Rankings

No comment