Your Position: Home > Recombinant Protein > Recombinant Tachypleus tridentatus Tachylectin-2

Recombinant Tachypleus tridentatus Tachylectin-2AP73891

Catalog No.	Package Size	Price
AP73891-1	10ug	$105.00
AP73891-2	50ug	$260.00
AP73891-3	100ug	$454.00
AP73891-4	200ug	$735.00
AP73891-5	500ug	$1240.00
AP73891-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Tachypleus tridentatus Tachylectin-2
Brief Description Recombinant Protein
Host Species E.coli
Alternative Names Lectin L10c
Accession No. Uniprot ID: Q27084
Target Species Tachypleus tridentatus (Japanese horseshoe crab)
SDS-PAGE MW 42.77kDa
Target Length Full Length,20-255aa
Tag Info N-terminal 6xHis-SUMO-tagged
Target Sequence VGGESMLRGVYQDKFYQGTYPQNKNDNWLARATLIGKGGWSNFKFLFLSPGGELYGVLNDKIYKGTPPTHDNDNWMGRAKKIGNGGWNQFQFLFFDPNGYLYAVSKDKLYKASPPQSDTDNWIARATEIGSGGWSGFKFLFFHPNGYLYAVHGQQFYKALPPVSNQDNWLARATKIGQGGWDTFKFLFFSSVGTLFGVQGGKFYEDYPPSYAHDNWLARAKLIGNGGWDDFRFLFF
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

Lectin that binds specifically to N-acetylglucosamine and N-acetylgalactosamine. Is part of the innate immunity host defense system of the horseshoe crab.

Regerences

"Purification, characterization, and cDNA cloning of a 27-kDa lectin (L10) from horseshoe crab hemocytes."Okino N., Kawabata S., Saito T., Hirata M., Takagi T., Iwanaga S.J. Biol. Chem. 270:31008-31015(1995)

Published Papers

let us know

Customer Reviews and Rankings

No comment