Your Position: Home > Recombinant Protein > Recombinant Rift valley fever virus Nucleoprotein(N)

Recombinant Rift valley fever virus Nucleoprotein(N)AP73885

Catalog No.	Package Size	Price
AP73885-1	10ug	$105.00
AP73885-2	50ug	$260.00
AP73885-3	100ug	$454.00
AP73885-4	200ug	$735.00
AP73885-5	500ug	$1240.00
AP73885-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Rift valley fever virus Nucleoprotein(N)
Brief Description Recombinant Protein
Host Species E.coli
Target Name N
Alternative Names Nucleocapsid protein Short name:Protein N
Accession No. Uniprot ID: P21700
Target Species Rift valley fever virus (strain ZH-548 M12) (RVFV)
SDS-PAGE MW 43.41kDa
Target Length Full Length,1-245aa
Tag Info N-terminal 6xHis-SUMO-tagged
Target Sequence MDNYQELRVQFAAQAVDRNEIEQWVREFAYQGFDARRVIELLKQYGGADWEKDAKKMIVLALTRGNKPRRMMMKMSKEGKATVEALINKYKLKEGNPSRDELTLSRVAAALAGWTCQALVVLSEWLPVTGTTMDGLSPAYPRHMMHPSFAGMVDPSLPGDYLRAILDAHSLYLLQFSRVINPNLRGRTKEEVAATFTQPMNAAVNSNFISHEKRREFLKAFGLVDSNGKPSAAVMAAAQAYKTAA
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Regerences

"Sequences and coding strategies of the S RNAs of Toscana and Rift Valley fever viruses compared to those of Punta Toro, Sicilian Sandfly fever, and Uukuniemi viruses."Giorgi C., Accardi L., Nicoletti L., Gro M.C., Takehara K., Hilditch C., Morikawa S., Bishop D.H.L.Virology 180:738-753(1991)

Published Papers

let us know

Customer Reviews and Rankings

No comment