Your Position: Home > Recombinant Protein > Recombinant Oxyopes takobius Oxyopinin-4a(oxt 4a)

Recombinant Oxyopes takobius Oxyopinin-4a(oxt 4a)AP73807

Catalog No.	Package Size	Price
AP73807-1	10ug	$105.00
AP73807-2	50ug	$260.00
AP73807-3	100ug	$454.00
AP73807-4	200ug	$735.00
AP73807-5	500ug	$1240.00
AP73807-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Oxyopes takobius Oxyopinin-4a(oxt 4a)
Brief Description Recombinant Protein
Host Species E.coli
Target Name oxt 4a
Alternative Names Oxt-4a
Accession No. Uniprot ID: F8J4S0
Target Species Oxyopes takobius (Lynx spider) (Oxyopes foliiformis)
SDS-PAGE MW 19.61kDa
Target Length Full Length,48-77aa
Tag Info N-terminal 6xHis-SUMO-tagged
Target Sequence GIRCPKSWKCKAFKQRVLKRLLAMLRQHAF
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

Disrupts cell membranes through the formation of pores (Probable). Has antibacterial activity against Gram-positive bacteria S.aureus (MIC=10 M) and B.subtilis (MIC=0.5 M) as well as Gram-negative bacteria P.fluorescens (MIC=1 M) and E.coli (MIC=0.5 M). Has hemolytic activity against human erythrocytes (EC(50)=7 M)

Regerences

"Novel lynx spider toxin shares common molecular architecture with defense peptides from frog skin."Dubovskii P.V., Vassilevski A.A., Samsonova O.V., Egorova N.S., Kozlov S.A., Feofanov A.V., Arseniev A.S., Grishin E.V.FEBS J. 278:4382-4393(2011)

Published Papers

let us know

Customer Reviews and Rankings

No comment