Your Position: Home > Recombinant Protein > Recombinant Salmonella typhi LPS-assembly protein LptD(lptD),partial

Recombinant Salmonella typhi LPS-assembly protein LptD(lptD),partialAP73796

Catalog No.	Package Size	Price
AP73796-1	10ug	$105.00
AP73796-2	50ug	$260.00
AP73796-3	100ug	$454.00
AP73796-4	200ug	$735.00
AP73796-5	500ug	$1240.00
AP73796-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Salmonella typhi LPS-assembly protein LptD(lptD),partial
Brief Description Recombinant Protein
Host Species E.coli
Target Name lptD
Accession No. Uniprot ID: Q8Z9J6
Target Species Salmonella typhi
SDS-PAGE MW 26.91kDa
Target Length Partial,73-169aa
Tag Info N-terminal 6xHis-SUMO-tagged
Target Sequence VDIMQGNSRLQADEVQLHQKQAEGQPEPVRTVDALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYTILENGS
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

Together with LptE, is involved in the assembly of lipopolysaccharide (LPS) at the surface of the outer membrane.

Regerences

"Complete genome sequence of a multiple drug resistant Salmonella enterica serovar Typhi CT18."Parkhill J., Dougan G., James K.D., Thomson N.R., Pickard D., Wain J., Churcher C.M., Mungall K.L., Bentley S.D., Holden M.T.G., Sebaihia M., Baker S., Basham D., Brooks K., Chillingworth T., Connerton P., Cronin A., Davis P. Barrell B.G.Nature 413:848-852(2001)

Published Papers

let us know

Customer Reviews and Rankings

No comment