Your Position: Home > Recombinant Protein > Recombinant Blomia tropicalis Mite allergen Blo t 5(BLOT5)

Recombinant Blomia tropicalis Mite allergen Blo t 5(BLOT5)AP73783

Catalog No.	Package Size	Price
AP73783-1	10ug	$105.00
AP73783-2	50ug	$260.00
AP73783-3	100ug	$454.00
AP73783-4	200ug	$735.00
AP73783-5	500ug	$1240.00
AP73783-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Blomia tropicalis Mite allergen Blo t 5(BLOT5)
Brief Description Recombinant Protein
Host Species E.coli
Target Name BLOT5
Alternative Names Allergen: Blo t 5
Accession No. Uniprot ID: O96870
Target Species Blomia tropicalis (Mite)
SDS-PAGE MW 31.63kDa
Target Length Full Length,1-134aa
Tag Info N-terminal 6xHis-SUMO-tagged
Target Sequence MKFAIVLIACFAASVLAQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Regerences

"Sensitization to Blomia tropicalis in patients with asthma and identification of allergen Blo t 5."Arruda L.K., Vailes L.D., Platts-Mills T.A.E., Fernandez-Caldas E., Montealegre F., Lin K.-L., Chua K.-Y., Rizzo M.C., Naspitz C.K., Chapman M.D.Am. J. Respir. Crit. Care Med. 155:343-350(1997)

Published Papers

let us know

Customer Reviews and Rankings

No comment