Your Position: Home > Recombinant Protein > Recombinant Naja atra Cytotoxin 4

Recombinant Naja atra Cytotoxin 4AP73781

Catalog No.	Package Size	Price
AP73781-1	10ug	$105.00
AP73781-2	50ug	$260.00
AP73781-3	100ug	$454.00
AP73781-4	200ug	$735.00
AP73781-5	500ug	$1240.00
AP73781-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Naja atra Cytotoxin 4
Brief Description Recombinant Protein
Host Species E.coli
Alternative Names Cardiotoxin A4 Short name: CTX A4 Cardiotoxin analog IV Short name: CTX IV
Accession No. Uniprot ID: P01443
Target Species Naja atra (Chinese cobra)
SDS-PAGE MW 22.79kDa
Target Length Full Length,22-81aa
Tag Info N-terminal 6xHis-SUMO-tagged
Target Sequence RKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

Basic protein that bind to cell membrane and depolarizes cardiomyocytes. This cytotoxin also shows lytic activities, but 2-fold more important than that of CTX-A2. It binds to the integrin alpha-V/beta-3 with a moderate affinity. Inhibits protein kinase C. It may interact with sulfatides in the cell membrane, which induces pore formation and cell internalization and is responsible for cytotoxicity in cardiomyocytes. It also may target the mitochondrial membrane and induces mitochondrial swelling and fragmentation.

Regerences

"Genomic structures of cardiotoxin 4 and cobrotoxin from Naja naja atra (Taiwan cobra)."Chang L.-S., Lin J., Chou Y.-C., Hong E.Biochem. Biophys. Res. Commun. 239:756-762(1997)

Published Papers

let us know

Customer Reviews and Rankings

No comment