Your Position: Home > Recombinant Protein > Recombinant Bacillus sp. Levanase,partial

Recombinant Bacillus sp. Levanase,partialAP73779

Catalog No.	Package Size	Price
AP73779-1	10ug	$105.00
AP73779-2	50ug	$260.00
AP73779-3	100ug	$454.00
AP73779-4	200ug	$735.00
AP73779-5	500ug	$1240.00
AP73779-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Bacillus sp. Levanase,partial
Brief Description Recombinant Protein
Host Species E.coli
Alternative Names 2,6-beta-D-fructan fructanohydrolase Endo-levanase
Accession No. Uniprot ID: O31411
Target Species Bacillus sp. (strain L7)
SDS-PAGE MW 30.31kDa
Target Length Partial,451-579aa
Tag Info N-terminal 6xHis-SUMO-tagged
Target Sequence LPWNDLGHVWSGSAVADTTNASGLFGSSGGKGLIAYYTSYNPDRHNGNQKIGLAYSTDRGRTWKYSEEHPVVIENPGKTGEDPGGWDFRDPKVVRDEANNRWVMVVSGGDHIRLFTSTNLLNWTLTDQF
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

Catalyzes the hydrolysis of levan with endo-type specificity. The products of levan hydrolysis are a mixture of fructose and a series of fructooligosaccharides up to 12-mer, with levantriose being the major oligosaccharide obtained. Is not active towards sucrose.

Regerences

"Characterization of a novel endo-levanase and its gene from Bacillus sp. L7."Miasnikov A.N.FEMS Microbiol. Lett. 154:23-28(1997)

Published Papers

let us know

Customer Reviews and Rankings

No comment