Your Position: Home > Recombinant Protein > Recombinant Saccharomyces cerevisiae GTP-binding protein YPT1(YPT1)

Recombinant Saccharomyces cerevisiae GTP-binding protein YPT1(YPT1)AP73774

Catalog No.	Package Size	Price
AP73774-1	10ug	$105.00
AP73774-2	50ug	$260.00
AP73774-3	100ug	$454.00
AP73774-4	200ug	$735.00
AP73774-5	500ug	$1240.00
AP73774-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Saccharomyces cerevisiae GTP-binding protein YPT1(YPT1)
Brief Description Recombinant Protein
Host Species E.coli
Target Name YPT1
Alternative Names Protein YP2 Rab GTPase YPT1 Transport GTPase YPT1
Accession No. Uniprot ID: P01123
Target Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker
SDS-PAGE MW 39.2kDa
Target Length Full Length,1-206aa
Tag Info N-terminal 6xHis-SUMO-tagged
Target Sequence MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQSLTNTGGGCC
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. YPT1 regulates the trafficking of secretory vesicles from the endoplasmic reticulum (ER) to the Golgi. Vesicular transport depends on shuttling of YPT1 between membrane and cytosol by GDI1, probably by recycling it to its membrane of origin after a vesicle fusion event. Plays a role in the initial events of the autophagic vacuole development which take place at specialized regions of the endoplasmic reticulum. Also involved in the recycling of membrane proteins.

Regerences

"A yeast gene encoding a protein homologous to the human c-has/bas proto-oncogene product."Gallwitz D., Donath C., Sander C.Nature 306:704-707(1983)

Published Papers

let us know

Customer Reviews and Rankings

No comment