Your Position: Home > Recombinant Protein > Recombinant Mouse Low affinity immunoglobulin gamma Fc region receptor III(Fcgr3),partial

Recombinant Mouse Low affinity immunoglobulin gamma Fc region receptor III(Fcgr3),partialAP73770

Catalog No.	Package Size	Price
AP73770-1	10ug	$105.00
AP73770-2	50ug	$260.00
AP73770-3	100ug	$454.00
AP73770-4	200ug	$735.00
AP73770-5	500ug	$1240.00
AP73770-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Mouse Low affinity immunoglobulin gamma Fc region receptor III(Fcgr3),partial
Brief Description Recombinant Protein
Host Species E.coli
Target Name Fcgr3
Alternative Names Fc-gamma RIII Short name: FcRIII CD_antigen: CD16
Accession No. Uniprot ID: P08508
Target Species Ms
SDS-PAGE MW 37.14kDa
Target Length Extracellular Domain,31-215aa
Tag Info N-terminal 6xHis-SUMO-tagged
Target Sequence ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor.

Regerences

"Structural heterogeneity and functional domains of murine immunoglobulin G Fc receptors."Ravetch J.V., Luster A.D., Weinshank R., Kochan J., Pavlovec A., Portnoy D.A., Hulmes J., Pan Y.-C.E., Unkeless J.C.Science 234:718-725(1986)

Published Papers

let us know

Customer Reviews and Rankings

No comment