Your Position: Home > Recombinant Protein > Recombinant Mouse Homeobox protein Nkx-2.2(Nkx2-2)

Recombinant Mouse Homeobox protein Nkx-2.2(Nkx2-2)AP73768

Catalog No.	Package Size	Price
AP73768-1	10ug	$105.00
AP73768-2	50ug	$260.00
AP73768-3	100ug	$454.00
AP73768-4	200ug	$735.00
AP73768-5	500ug	$1240.00
AP73768-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Mouse Homeobox protein Nkx-2.2(Nkx2-2)
Brief Description Recombinant Protein
Host Species E.coli
Target Name Nkx2-2
Alternative Names Homeobox protein NK-2 homolog B
Accession No. Uniprot ID: P42586
Target Species Ms
SDS-PAGE MW 46.11kDa
Target Length Full Length,1-273aa
Tag Info N-terminal 6xHis-SUMO-tagged
Target Sequence MSLTNTKTGFSVKDILDLPDTNDEDGSVAEGPEEESEGPEPAKRAGPLGQGALDAVQSLPLKSPFYDSSDNPYTRWLASTEGLQYSLHGLAASAPPQDSSSKSPEPSADESPDNDKETQGGGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVAVPVLVRDGKPCHALKAQDLAAATFQAGIPFSAYSAQSLQHMQYNAQYSSASTPQYPTAHPLVQAQQWTW
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

Acts as a transcriptional activator. Required for the maintenance of NEUROD1 expression in the horomone-producing endocrine cells of the pancreas. May be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance. Associates with chromatin at the NEUROD1 promoter region. Binds to a subset of consensus elements within the NEUROD1 promoter.

Regerences

"Regional expression of the homeobox gene Nkx-2.2 in the developing mammalian forebrain."Price M., Lazzaro D., Pohl T., Mattei M.-G., Ruether U., Olivo J.-C., Duboule D., di Lauro R.Neuron 8:241-255(1992)

Published Papers

let us know

Customer Reviews and Rankings

No comment