Your Position: Home > Recombinant Protein > Recombinant Saccharomyces cerevisiae Eukaryotic translation initiation factor 5A-1(HYP2)

Recombinant Saccharomyces cerevisiae Eukaryotic translation initiation factor 5A-1(HYP2)AP73765

Catalog No.	Package Size	Price
AP73765-1	10ug	$105.00
AP73765-2	50ug	$260.00
AP73765-3	100ug	$454.00
AP73765-4	200ug	$735.00
AP73765-5	500ug	$1240.00
AP73765-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Saccharomyces cerevisiae Eukaryotic translation initiation factor 5A-1(HYP2)
Brief Description Recombinant Protein
Host Species E.coli
Target Name HYP2
Alternative Names Hypusine-containing protein HP2 eIF-4D
Accession No. Uniprot ID: P23301
Target Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker
SDS-PAGE MW 32.97kDa
Target Length Full Length,2-157aa
Tag Info N-terminal 6xHis-SUMO-tagged
Target Sequence SDEEHTFETADAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDIDDGFLSLMNMDGDTKDDVKAPEGELGDSLQTAFDEGKDLMVTIISAMGEEAAISFKEAARTD
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. Essential for polarized growth, a process necessary for G1/S transition. May mediate large range of effects of the polyamine spermidine in the cell.

Regerences

"Translation initiation factor 5A and its hypusine modification are essential for cell viability in the yeast Saccharomyces cerevisiae." Schnier J., Schwelberger H.G., Smit-Mcbride Z., Kang H.A., Hershey J.W.B.Mol. Cell. Biol. 11:3105-3114(1991)

Published Papers

let us know

Customer Reviews and Rankings

No comment