Your Position: Home > Recombinant Protein > Recombinant Human Interleukin 6 receptor(IL6R),partial

Recombinant Human Interleukin 6 receptor(IL6R),partialAP73749

Catalog No.	Package Size	Price
AP73749-1	10ug	$105.00
AP73749-2	50ug	$260.00
AP73749-3	100ug	$454.00
AP73749-4	200ug	$735.00
AP73749-5	500ug	$1240.00
AP73749-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Human Interleukin 6 receptor(IL6R),partial
Brief Description Recombinant Protein
Host Species Yeast
Target Name IL6R
Alternative Names Interleukin 6 receptor, isoform CRA_a
Accession No. Uniprot ID: A0N0L5
Target Species Hu
SDS-PAGE MW 40.54kDa
Target Length Partial,20-365aa
Tag Info N-terminal 6xHis-tagged
Target Sequence LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

cytokine receptor activity

Regerences

"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Gerhard D.S., Wagner L., Feingold E.A., Shenmen C.M., Grouse L.H., Schuler G., Klein S.L., Old S., Rasooly R., Good P., Guyer M., Peck A.M., Derge J.G., Lipman D., Collins F.S., Jang W., Sherry S., Feolo M. Malek J.Genome Res. 14:2121-2127(2004)

Published Papers

let us know

Customer Reviews and Rankings

No comment