Welcome     Login   Register   Message Board   
Your Position: Home > Recombinant Protein > Recombinant Human Activin receptor type-2B(ACVR2B),partial

Recombinant Human Activin receptor type-2B(ACVR2B),partialAP73748

  Catalog No. Package Size Price
AP73748-1 10ug $105.00
AP73748-2 50ug $260.00
AP73748-3 100ug $454.00
AP73748-4 200ug $735.00
AP73748-5 500ug $1240.00
AP73748-6 1mg $1980.00

Quantity:  Total:   
 

Review:comment rank 5 pdf

Availability: promotionThe lead time is currently 7-30 days.

add promotion
Description
  • Product Name Recombinant Human Activin receptor type-2B(ACVR2B),partial
  • Brief Description Recombinant Protein
  • Host Species Yeast
  • Target Name ACVR2B
  • Alternative Names Activin receptor type IIB Short name: ACTR-IIB
  • Accession No. Uniprot ID: Q13705
  • Target Species Hu
  • SDS-PAGE MW 15.66kDa
  • Target Length Extracellular Domain,19-137aa
  • Tag Info N-terminal 6xHis-tagged
  • Target Sequence SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTLLT
  • Formulation Tris-based buffer,50% glycerol
  • Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.
Application Details

Greater than 90% as determined by SDS-PAGE.

Images
  • Recombinant Human Activin receptor type-2B(ACVR2B),partial - Absci


Background
Transmembrane serine/threonine kinase activin type-2 receptor forming an activin receptor complex with activin type-1 serine/threonine kinase receptors (ACVR1, ACVR1B or ACVR1c). Transduces the activin signal from the cell surface to the cytoplasm and is thus regulating many physiological and pathological processes including neuronal differentiation and neuronal survival, hair follicle development and cycling, FSH production by the pituitary gland, wound healing, Extracellular domain matrix production, immunosuppression and carcinogenesis. Activin is also thought to have a paracrine or autocrine role in follicular development in the ovary. Within the receptor complex, the type-2 receptors act as a primary activin receptors (binds activin-A/INHBA, activin-B/INHBB as well as inhibin-A/INHA-INHBA). The type-1 receptors like ACVR1B act as downstream transducers of activin signals. Activin binds to type-2 receptor at the plasma membrane and activates its serine-threonine kinase. The activated receptor type-2 then phosphorylates and activates the type-1 receptor. Once activated, the type-1 receptor binds and phosphorylates the SMAD proteins SMAD2 and SMAD3, on serine residues of the C-terminal tail. Soon after their association with the activin receptor and subsequent phosphorylation, SMAD2 and SMAD3 are released into the cytoplasm where they interact with the common partner SMAD4. This SMAD complex translocates into the nucleus where it mediates activin-induced transcription. Inhibitory SMAD7, which is recruited to ACVR1B through FKBP1A, can prevent the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. Activin signal transduction is also antagonized by the binding to the receptor of inhibin-B via the IGSF1 inhibin coreceptor.
Regerences
"Expression of type II activin receptor genes during differentiation of human K562 cells and cDNA cloning of the human type IIB activin receptor."Hilden K., Tuuri T., Eramaa M., Ritvos O.Blood 83:2163-2170(1994)
    Please let us know if you have published research using #AP73748 so that we can cite your reference.
Customer Reviews and Rankings
  • No comment
  • Total 0 results, divided into1 pages. First Prev Next Last

    My Review

    Username: Anonymous user
    E-mail:
    Ratings:
    Content:
    Verification code: captcha
     
    Protocol
    Browsing historyclear
    Note
      Application:
    • WBWestern Blotting
    • IHCImmunohistochemistry
    • IFImmunofluorescence
    • ICCImmunocytochemistry
    • FCFlow Cytometry
    • IPImmunoprecipitation
    • EELISA
    • DBDot Blotting
    • ChIPChromatin Immunoprecipitation
    • GICAGold Immunochromatography Assay
    • NCNegative Control
      Species Reactivity:
    • HuHuman
    • MsMouse 
    • RtRat 
    • Dm Drosophila melanogaster
    • C Caenorhabditis elegans
    • MkMonkey
    • RbRabbit
    • B Bovine 
    • D Dog
    • PPig
    • HmHamster
    • ChHm Chinese Hamster 
    • ChkChicken  
    • ShpSheep  


    © 2017, AbSci All Rights Reserved. E-mail: info@abscitech.com
    南京川博生物技术有限公司版权所有
    苏B1-20150380 苏ICP备15009006号-1