Your Position: Home > Recombinant Protein > Recombinant Mouse WNT1-inducible-signaling pathway protein 2(Wisp2)

Recombinant Mouse WNT1-inducible-signaling pathway protein 2(Wisp2)AP73746

Catalog No.	Package Size	Price
AP73746-1	10ug	$105.00
AP73746-2	50ug	$260.00
AP73746-3	100ug	$454.00
AP73746-4	200ug	$735.00
AP73746-5	500ug	$1240.00
AP73746-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Mouse WNT1-inducible-signaling pathway protein 2(Wisp2)
Brief Description Recombinant Protein
Host Species Yeast
Target Name Wisp2
Alternative Names CCN family member 5 Connective tissue growth factor-like protein Short name: CTGF-L
Accession No. Uniprot ID: Q9Z0G4
Target Species Ms
SDS-PAGE MW 26.52kDa
Target Length Full Length,24-251aa
Tag Info N-terminal 6xHis-tagged
Target Sequence QLCPAPCACPWTPPQCPPGVPLVLDGCGCCRVCARRLGESCDHLHVCDPSQGLVCQPGAGPSGRGAVCLFEEDDGSCEVNGRRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVRLPSWDCPRPRRIQVPGRCCPEWVCDQAVMQPAIQPSSAQGHQLSALVTPASADGPCPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLSRPCLASRSHGSWNSAF
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production (By similarity).

Regerences

"Identification and cloning of a connective tissue growth factor-like cDNA from human osteoblasts encoding a novel regulator of osteoblast functions."Kumar S., Hand A.T., Connor J.R., Dodds R.A., Ryan P.J., Trill J.J., Fisher S.M., Nuttall M.E., Lipshutz D.B., Zou C., Hwang S.M., Votta B.J., James I.E., Rieman D.J., Gowen M., Lee J.C.J. Biol. Chem. 274:17123-17131(1999)

Published Papers

let us know

Customer Reviews and Rankings

No comment