Your Position: Home > Recombinant Protein > Recombinant Human CTP synthase 1(CTPS1)

Recombinant Human CTP synthase 1(CTPS1)AP73745

Catalog No.	Package Size	Price
AP73745-1	10ug	$105.00
AP73745-2	50ug	$260.00
AP73745-3	100ug	$454.00
AP73745-4	200ug	$735.00
AP73745-5	500ug	$1240.00
AP73745-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Human CTP synthase 1(CTPS1)
Brief Description Recombinant Protein
Host Species Yeast
Target Name CTPS1
Alternative Names CTP synthetase 1 UTP--ammonia ligase 1
Accession No. Uniprot ID: P17812
Target Species Hu
SDS-PAGE MW 68.69kDa
Target Length Full Length,1-591aa
Tag Info N-terminal 6xHis-tagged
Target Sequence MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDANSTEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRHRFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINHD
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

This enzyme is involved in the de novo synthesis of CTP, a precursor of DNA, RNA and phospholipids. Catalyzes the ATP-dependent amination of UTP to CTP with either L-glutamine or ammonia as a source of nitrogen. This enzyme and its product, CTP, play a crucial role in the proliferation of activated lymphocytes and therefore in immunity.

Regerences

"Molecular cloning of the human CTP synthetase gene by functional complementation with purified human metaphase chromosomes."Yamauchi M., Yamauchi N., Meuth M.EMBO J. 9:2095-2099(1990)

Published Papers

let us know

Customer Reviews and Rankings

No comment