Your Position: Home > Recombinant Protein > Recombinant Human Store-opeRated calcium entry-associated regulatory factor(SARAF),partial

Recombinant Human Store-opeRated calcium entry-associated regulatory factor(SARAF),partialAP73744

Catalog No.	Package Size	Price
AP73744-1	10ug	$105.00
AP73744-2	50ug	$260.00
AP73744-3	100ug	$454.00
AP73744-4	200ug	$735.00
AP73744-5	500ug	$1240.00
AP73744-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Human Store-opeRated calcium entry-associated regulatory factor(SARAF),partial
Brief Description Recombinant Protein
Host Species Yeast
Target Name SARAF
Alternative Names HBV X-transactivated gene 3 protein HBV XAg-transactivated protein 3 Protein FOAP-7 Transmembrane protein 66
Accession No. Uniprot ID: Q96BY9
Target Species Hu
SDS-PAGE MW 17.48kDa
Target Length Cytoplasmic Domain,195-339aa
Tag Info N-terminal 6xHis-tagged
Target Sequence SDGQYSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGLGTGGILGYLFGSNRAATPFSDSWYYPSYPPSYPGTWNRAYSPLHGGSGSYSVCSNSDTKTRTASGYGGTRRR
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

Negative regulator of store-operated Ca2+ entry (SOCE) involved in protecting cells from Ca2+ overfilling. In response to cytosolic Ca2+ elevation after endoplasmic reticulum Ca2+ refilling, promotes a slow inactivation of STIM (STIM1 or STIM2)-dependent SOCE activity: possibly act by facilitating the deoligomerization of STIM to efficiently turn off ORAI when the endoplasmic reticulum lumen is filled with the appropriate Ca2+ levels, and thus preventing the overload of the cell with excessive Ca2+ ions.

Regerences

"Molecular cloning of a human novel gene, FOAP-7, which are highly expressed in macrophages."Fujii Y., Tsuritani K., Yajima Y., Amemiya T., Ukai Y., Naito K., Kawaguchi A., Takayama K.Submitted (JUN-1999)

Published Papers

let us know

Customer Reviews and Rankings

No comment