Your Position: Home > Recombinant Protein > Recombinant Mouse Interleukin-1 family member 10(Il1f10)

Recombinant Mouse Interleukin-1 family member 10(Il1f10)AP73741

Catalog No.	Package Size	Price
AP73741-1	10ug	$105.00
AP73741-2	50ug	$260.00
AP73741-3	100ug	$454.00
AP73741-4	200ug	$735.00
AP73741-5	500ug	$1240.00
AP73741-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Mouse Interleukin-1 family member 10(Il1f10)
Brief Description Recombinant Protein
Host Species Yeast
Target Name Il1f10
Alternative Names IL-1F10
Accession No. Uniprot ID: Q8R459
Target Species Ms
SDS-PAGE MW 19.08kDa
Target Length Full Length,1-152aa
Tag Info N-terminal 6xHis-tagged
Target Sequence MCSLPMARYYIIKDAHQKALYTRNGQLLLGDPDSDNYSPEKVCILPNRGLDRSKVPIFLGMQGGSCCLACVKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQRSLGSAFRLEAAACPGWFLCGPAEPQQPVQLTKESEPSTHTEFYFEMSR
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by bacterial lipopolysaccharides (LPS). Ligand for IL-36R/IL1RL2 (By similarity).

Regerences

"Genomic organization of the interleukin-1 locus."Taylor S.L., Renshaw B.R., Garka K.E., Smith D.E., Sims J.E.Genomics 79:726-733(2002)

Published Papers

let us know

Customer Reviews and Rankings

No comment