Your Position: Home > Recombinant Protein > Recombinant Mouse Alpha/beta hydrolase domain-containing protein 11(Abhd11)

Recombinant Mouse Alpha/beta hydrolase domain-containing protein 11(Abhd11)AP73739

Catalog No.	Package Size	Price
AP73739-1	10ug	$105.00
AP73739-2	50ug	$260.00
AP73739-3	100ug	$454.00
AP73739-4	200ug	$735.00
AP73739-5	500ug	$1240.00
AP73739-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Mouse Alpha/beta hydrolase domain-containing protein 11(Abhd11)
Brief Description Recombinant Protein
Host Species Yeast
Target Name Abhd11
Alternative Names Williams-Beuren syndrome chromosomal region 21 protein homolog
Accession No. Uniprot ID: Q8K4F5
Target Species Ms
SDS-PAGE MW 35.56kDa
Target Length Full Length,1-307aa
Tag Info N-terminal 6xHis-tagged
Target Sequence MLRWARAWRVPRGVLGASSPRRLAVPVTFCSSRSSGQENADLRPLPLSYNLLDGDATLPAIVFLHGLFGSKTNFNSLAKAMVQRTGRRVLTVDARNHGDSPHSPDASYEAMSQDLQGLLPQLGLVPCVLVGHSMGGKTAMLLALQRPDVVERLVVVDISPVGTTPGSHIGAFIAAMKAVEIPEKVPHSQARKLADKQLSSVVKEAGIRQFLLTNLVEVGGRFSWRLNLDTLAQHLDKIMTFPQQREPYSGPTLFLLGGNSTYVQPSHHSEIRRLFPQAQIQTVPNAGHWVHSDKPQDFMDAVTSFLA
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Regerences

"Identification of additional transcripts in the Williams-Beuren syndrome critical region."Merla G., Ucla C., Guipponi M., Reymond A.Hum. Genet. 110:429-438(2002)

Published Papers

let us know

Customer Reviews and Rankings

No comment