Your Position: Home > Recombinant Protein > Recombinant Human Pro-neuregulin-2, membrane-bound isoform(NRG2),partial

Recombinant Human Pro-neuregulin-2, membrane-bound isoform(NRG2),partialAP73733

Catalog No.	Package Size	Price
AP73733-1	10ug	$105.00
AP73733-2	50ug	$260.00
AP73733-3	100ug	$454.00
AP73733-4	200ug	$735.00
AP73733-5	500ug	$1240.00
AP73733-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Human Pro-neuregulin-2, membrane-bound isoform(NRG2),partial
Brief Description Recombinant Protein
Host Species Yeast
Target Name NRG2
Alternative Names Divergent of neuregulin-1 Short name: DON-1 Neural- and thymus-derived activator for ERBB kinases Short name: NTAK
Accession No. Uniprot ID: O14511
Target Species Hu
SDS-PAGE MW 34.76kDa
Target Length Extracellular Domain,112-405aa
Tag Info N-terminal 6xHis-tagged
Target Sequence CYSPSLKSVQDQAYKAPVVVEGKVQGLVPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLKKMKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNKVKVEDAGEYVCEAENILGKDTVRGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQKAEELYQKR
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor.

Regerences

"A novel brain-derived member of the epidermal growth factor family that interacts with ErbB3 and ErbB4."Higashiyama S., Horikawa M., Yamada K., Ichino N., Nakano N., Nakagawa T., Miyagawa J., Matsushita N., Nagatsu T., Taniguchi N., Ishiguro H.J. Biochem. 122:675-680(1997)

Published Papers

let us know

Customer Reviews and Rankings

No comment