Your Position: Home > Recombinant Protein > Recombinant Rat Putative phospholipase B-like 2(Plbd2)

Recombinant Rat Putative phospholipase B-like 2(Plbd2)AP73732

Catalog No.	Package Size	Price
AP73732-1	10ug	$105.00
AP73732-2	50ug	$260.00
AP73732-3	100ug	$454.00
AP73732-4	200ug	$735.00
AP73732-5	500ug	$1240.00
AP73732-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Rat Putative phospholipase B-like 2(Plbd2)
Brief Description Recombinant Protein
Host Species Yeast
Target Name Plbd2
Alternative Names LAMA-like protein 2 Lamina ancestor homolog 2 Phospholipase B domain-containing protein 2
Accession No. Uniprot ID: Q4QQW8
Target Species Rt
SDS-PAGE MW 63.94kDa
Target Length Full Length,36-585aa
Tag Info N-terminal 6xHis-tagged
Target Sequence GALPTLGPGWRRQNPEPPASRTRSLLLDAASGQLRLEYGFHPDAVAWANLTNAIRETGWAYLDLGTNGSYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKSFLEANLEWMQREMELSPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFNIKPLGFLLLQISGDLEDLEPALNKTNTKPSVGSGSCSALIKLLPGSHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLIAGNNLIFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQGCVLEWIRNIVANRLALDGATWADVFRRFNSGTYNNQWMIVDYKAFIPNGPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFESVFNASGLQALVAQYGDWFSYTRNPRAKIFQRDQSLVEDVDTMVRLMRYNDFLHDPLSLCEACSPKPNAENAISARSDLNPANGSYPFQALRQRAHGGIDVKVTSVALAKYMSMLAASGPTWDQLPPFQWSKSPFHNMLHMGQPDLWMFSPVKVPWD
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

Putative phospholipase.

Regerences

"Genome sequence of the Brown Norway rat yields insights into mammalian evolution."Gibbs R.A., Weinstock G.M., Metzker M.L., Muzny D.M., Sodergren E.J., Scherer S., Scott G., Steffen D., Worley K.C., Burch P.E., Okwuonu G., Hines S., Lewis L., Deramo C., Delgado O., Dugan-Rocha S., Miner G., Morgan M. Collins F.S.Nature 428:493-521(2004)

Published Papers

let us know

Customer Reviews and Rankings

No comment