Your Position: Home > Recombinant Protein > Recombinant Human Butyrophilin subfamily 3 member A2(BTN3A2),partial

Recombinant Human Butyrophilin subfamily 3 member A2(BTN3A2),partialAP73730

Catalog No.	Package Size	Price
AP73730-1	10ug	$105.00
AP73730-2	50ug	$260.00
AP73730-3	100ug	$454.00
AP73730-4	200ug	$735.00
AP73730-5	500ug	$1240.00
AP73730-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Human Butyrophilin subfamily 3 member A2(BTN3A2),partial
Brief Description Recombinant Protein
Host Species Yeast
Target Name BTN3A2
Accession No. Uniprot ID: P78410
Target Species Hu
SDS-PAGE MW 25.61kDa
Target Length Extracellular Domain,30-248aa
Tag Info N-terminal 6xHis-tagged
Target Sequence QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

Plays a role in T-cell responses in the adaptive immune response. Inhibits the release of IFNG from activated T-cells.

Regerences

"Cloning, localization, and structure of new members of the butyrophilin gene family in the juxta-telomeric region of the major histocompatibility complex."Tazi-Ahnini R., Henry J., Offer C., Bouissou-Bouchouata C., Mather I.H., Pontarotti P.Immunogenetics 47:55-63(1997)

Published Papers

let us know

Customer Reviews and Rankings

No comment