Your Position: Home > Recombinant Protein > Recombinant Pan troglodytes Lymphotoxin-beta(LTB),partial

Recombinant Pan troglodytes Lymphotoxin-beta(LTB),partialAP73702

Catalog No.	Package Size	Price
AP73702-1	10ug	$105.00
AP73702-2	50ug	$260.00
AP73702-3	100ug	$454.00
AP73702-4	200ug	$735.00
AP73702-5	500ug	$1240.00
AP73702-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Pan troglodytes Lymphotoxin-beta(LTB),partial
Brief Description Recombinant Protein
Host Species E.coli
Target Name LTB
Alternative Names Tumor necrosis factor C; TNF-CTumor necrosis factor ligand superfamily member 3
Accession No. Uniprot ID: Q862Z7
Target Species Pan troglodytes (Chimpanzee)
SDS-PAGE MW 31.94kDa
Target Length Extracellular Domain,49-244aa
Tag Info N-terminal 6xHis-tagged
Target Sequence QDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSDAEGLALPQDGLYYLYCLVGYRGRTPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGAVMVG
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

Cytokine that binds to LTBR/TNFRSF3. May play a specific role in immune response regulation. Provides the mbrane anchor for the attachment of the heterotrimeric complex to the cell surface .

Regerences

Rapid evolution of major histocompatibility complex class I genes in primates generates new disease alleles in humans via hitchhiking diversity.Shiina T., Ota M., Shimizu S., Katsuyama Y., Hashimoto N., Takasu M., Anzai T., Kulski J.K., Kikkawa E., Naruse T., Kimura N., Yanagiya K., Watanabe A., Hosomichi K., Kohara S., Iwamoto C., Umehara Y., Meyer A. , Wanner V., Sano K., Macquin C., Ikeo K., Tokunaga K., Gojobori T., Inoko H., Bahram S.Genetics 173:1555-1570(2006)

Published Papers

let us know

Customer Reviews and Rankings

No comment