Your Position: Home > Recombinant Protein > Recombinant Human C-C motif chemokine 14(CCL14)

Recombinant Human C-C motif chemokine 14(CCL14) AP73699

Catalog No.	Package Size	Price
AP73699-1	10ug	$105.00
AP73699-2	50ug	$260.00
AP73699-3	100ug	$454.00
AP73699-4	200ug	$735.00
AP73699-5	500ug	$1240.00
AP73699-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Human C-C motif chemokine 14(CCL14)
Brief Description Recombinant Protein
Host Species E.coli
Target Name CCL14
Alternative Names Chemokine CC-1/CC-3; HCC-1/HCC-3HCC-1(1-74)NCC-2Small-inducible cytokine A14
Accession No. Uniprot ID: Q16627
Target Species Hu
SDS-PAGE MW 31.88kDa
Target Length Full Length,20-93aa
Tag Info N-terminal 6xHis-SUMO-tagged
Target Sequence TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

Has weak activities on human monocytes and acts via receptors that also recognize MIP-1 alpha. It induced intracellular Ca2+ changes and enzyme release, but no chotaxis, at concentrations of 100-1,000 nM, and was inactive on T-lymphocytes, neutrophils, and eosinophil leukocytes. Enhances the proliferation of CD34 myeloid progenitor cells. The processed form HCC-1(9-74) is a chotactic factor that attracts monocytes eosinophils, and T-cells and is a ligand for CCR1, CCR3 and CCR5.

Regerences

HCC-1, a novel chemokine from human plasma.Schulz-Knappe P., Maegert H.-J., Dewald B., Meyer M., Cetin Y., Kubbies M., Tomeczkowski J., Kirchhoff K., Raida M., Adermann K., Kist A., Reinecke M., Sillard R., Pardigol A., Uguccioni M., Baggiolini M., Forssmann W.-G.J. Exp. Med. 183:295-299(1996)

Published Papers

let us know

Customer Reviews and Rankings

No comment