Your Position: Home > Recombinant Protein > Recombinant Human herpesvirus 6A DNA polymerase processivity factor(U27)

Recombinant Human herpesvirus 6A DNA polymerase processivity factor(U27)AP73695

Catalog No.	Package Size	Price
AP73695-1	10ug	$105.00
AP73695-2	50ug	$260.00
AP73695-3	100ug	$454.00
AP73695-4	200ug	$735.00
AP73695-5	500ug	$1240.00
AP73695-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Human herpesvirus 6A DNA polymerase processivity factor(U27)
Brief Description Recombinant Protein
Host Species Yeast
Target Name U27
Alternative Names Phosphoprotein P41; PP41;Polymerase accessory protein; PAP
Accession No. Uniprot ID: P27417
Target Species Hu
SDS-PAGE MW 31.80kDa
Target Length Full Length,1-393aa
Tag Info N-terminal 6xHis-tagged
Target Sequence FFFFKAHKARVGARTSFLTEMERGSRDHHRDHRDHREHRETREPPTLAFHMKSWKTINKSLKAFAKLLKENATVTFTPQPSIIIQSAKNHLVQKLTIQAECLFLSDTDRFLTKTINNHIPLFESFMNIISNPEVTKMYIQHDSDLYTRVLVTASDTCTQASVPCVHGQEVVRDTGRSPLRIDLDHSTVSDVLKWLSPVTKTKRSGKSDALMAHIIVQVNPPTIKFVTEMNELEFSNSNKVIFYDVKNMRFNLSAKNLQQALSMCAVIKTSCSLRTVAAKDCKLILTSKSTLLTVEAFLTQEQLKEESRFERMGKQDDGKGDRSHKNEDGSALASKQEMQYEITNYMVPAKNGTAGSSLFNEKEDSESDDSMHFDYSSNPNPKRQRCVV
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

Accessory subunit of the DNA polymerase that acts to increase the processivity of polymerization.

Regerences

Identification, characterization, and sequence analysis of a cDNA encoding a phosphoprotein of human herpesvirus 6.Chang C.K., Balachandran N.J. Virol. 65:2884-2894(1991)

Published Papers

let us know

Customer Reviews and Rankings

No comment