Your Position: Home > Recombinant Protein > Recombinant Epstein-Barr virus Capsid protein VP26 (BFRF3),partial

Recombinant Epstein-Barr virus Capsid protein VP26 (BFRF3),partialAP73694

Catalog No.	Package Size	Price
AP73694-1	10ug	$105.00
AP73694-2	50ug	$260.00
AP73694-3	100ug	$454.00
AP73694-4	200ug	$735.00
AP73694-5	500ug	$1240.00
AP73694-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Epstein-Barr virus Capsid protein VP26 (BFRF3),partial
Brief Description Recombinant Protein
Host Species E.coli
Target Name BFRF3
Accession No. Uniprot ID: P14348
Target Species Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus
SDS-PAGE MW 31.75kDa
Target Length Partial,31-176aa
Tag Info N-terminal 6xHis-SUMO-tagged
Target Sequence NQNNLPNDVFREAQRSYLVFLTSQFCYEEYVQRTFGVPRRQRAIDKRQRASVAGAGAHAHLGGSSATPVQQAQAAASAGTGALASSAPSTAVAQSATPSVSSSISSLRAATSGATAAASAAAAVDTGSGGGGQPHDTAPRGARKKQ
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Regerences

DNA sequence and expression of the B95-8 Epstein-Barr virus genome.Baer R., Bankier A.T., Biggin M.D., Deininger P.L., Farrell P.J., Gibson T.J., Hatfull G., Hudson G.S., Satchwell S.C., Seguin C., Tuffnell P.S., Barrell B.G.Nature 310:207-211(1984)

Published Papers

let us know

Customer Reviews and Rankings

No comment