Your Position: Home > Recombinant Protein > Recombinant Human Glutathione peroxidase 1(GPX1)

Recombinant Human Glutathione peroxidase 1(GPX1)AP73680

Catalog No.	Package Size	Price
AP73680-1	10ug	$105.00
AP73680-2	50ug	$260.00
AP73680-3	100ug	$454.00
AP73680-4	200ug	$735.00
AP73680-5	500ug	$1240.00
AP73680-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Human Glutathione peroxidase 1(GPX1)
Brief Description Recombinant Protein
Host Species E.coli
Target Name GPX1
Alternative Names Cellular glutathione peroxidase
Accession No. Uniprot ID: P07203
Target Species Hu
SDS-PAGE MW 31.33kDa
Target Length Full Length,1-203aa
Tag Info N-terminal 6xHis-tagged
Target Sequence MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

Protects the hoglobin in erythrocytes from oxidative breakdown.

Regerences

An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)

Published Papers

let us know

Customer Reviews and Rankings

No comment