Your Position: Home > Recombinant Protein > Recombinant Hepatitus C virus Genome Polyprotien

Recombinant Hepatitus C virus Genome PolyprotienAP73188

Catalog No.	Package Size	Price
AP73188-1	20ug	$470.00
AP73188-2	50ug	$935.00
AP73188-3	100ug	$1305.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Hepatitus C virus Genome Polyprotien
Brief Description Recombinant Protein
Host Species Mammalian cell
Target Name POLG
Accession No. Uniprot ID: Q05794
Target Species HAVHA
Calculated MW 19.6kD
Target Length Partial, 192-325aa
Tag Info HIS
Target Sequence AYHFKDPQYPVWELTIRVWSELNIGTGTSAYTSLNVLARFTDLELHGLTPLSTQMMRNEFRVSTTENVVNLSNYEDARAKMSFALDQEDWKSDPSQGGGIKITHFTTWTSIPTLAAQFPFNASDSVGQQIKVIP
Formulation 20mM Tris-HCl based buffer,pH8.0
Storage Store at -20˚C, for extended storage, conserve at -20˚C or -80˚C. Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details

Purity: Greater than 90% as determined by SDS-PAGE.

Images

Background

Capsid proteins VP1, VP2, and VP3 form a closed capsid enclosing the viral positive strand RNA genome. All these proteins contain a beta-sheet structure called beta-barrel jelly roll. Together they form an icosahedral capsid (T=3) composed of 60 copies of each VP1, VP2, and VP3, with a diameter of approximately 300 Angstroms. VP1 is situated at the 12 fivefold axes, whereas VP2 and VP3 are located at the quasi-sixfold axes. The capsid interacts with HAVCR1 to provide virion attachment to target cell.

Published Papers

let us know

Customer Reviews and Rankings

No comment