Your Position: Home > Recombinant Protein > Recombinant Mus musculus Mixed lineage kinase domain-like protein

Recombinant Mus musculus Mixed lineage kinase domain-like proteinAP73118

Catalog No.	Package Size	Price
AP73118-1	50ug	$260.00
AP73118-2	200ug	$735.00
AP73118-3	500ug	$1240.00
AP73118-4	1mg	$1975.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Mus musculus Mixed lineage kinase domain-like protein
Brief Description Recombinant Protein
Host Species Yeast
Target Name MLKL
Accession No. Uniprot ID: Q9D2Y4
Target Species MOUSE
Calculated MW 56.3kD
Target Length Full length, 1-472aa
Tag Info His-tag
Target Sequence MDKLGQIIKLGQLIYEQCEKMKYCRKQCQRLGNRVHGLLQPLQRLQAQGKKNLPDDITAALGRFDEVLKEANQQIEKFSKKSHIWKFVSVGNDKILFHEVNEKLRDVWEELLLLLQVYHWNTVSDVSQPASWQQEDRQDAEEDGNENMKVILMQLQISVEEINKTLKQCSLKPTQEIPQDLQIKEIPKEHLGPPWTKLKTSKMSTIYRGEYHRSPVTIKVFNNPQAESVGIVRFTFNDEIKTMKKFDSPNILRIFGICIDQTVKPPEFSIVMEYCELGTLRELLDREKDLTMSVRSLLVLRAARGLYRLHHSETLHRNISSSSFLVAGGYQVKLAGFELSKTQNSISRTAKSTKAERSSSTIYVSPERLKNPFCLYDIKAEIYSFGIVLWEIATGKIPFEGCDSKKIRELVAEDKKQEPVGQDCPELLREIINECRAHEPSQRPSVDGRSLSGRERILERLSAVEESTDKKV
Formulation 20mM Tris-HCl based buffer,pH8.0
Storage Store at -20˚C, for extended storage, conserve at -20˚C or -80˚C. Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details

Purity: Greater than 90% as determined by SDS-PAGE.

Images

Background

Pseudokinase that plays a key role in TNF-induced necroptosis, a programmed cell death process. Activated following phosphorylation by RIPK3, leading to homotrimerization, localization to the plasma mbrane and execution of programmed necrosis characterized by calcium influx and plasma mbrane damage. Does not have protein kinase activity.

Published Papers

let us know

Customer Reviews and Rankings

No comment