Your Position: Home > Recombinant Protein > Recombinant Bos taurus C-C motif chemokine 20

Recombinant Bos taurus C-C motif chemokine 20AP73104

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Bos taurus C-C motif chemokine 20
Brief Description Recombinant Protein
Host Species Yeast
Target Name CCL20
Accession No. Uniprot ID: Q8SQB1
Target Species BOVIN
Calculated MW 10.11kD
Target Length Full length, 27-96aa
Tag Info His-tag
Target Sequence ASNFDCCLRYTERILHPSILVGFTQQLANEACDINAVVFYTRKKLAVCADPKKKWVKQVVHMLSQRVKRM
Formulation 20mM Tris-HCl based buffer,pH8.0
Storage Store at -20˚C, for extended storage, conserve at -20˚C or -80˚C. Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.