Your Position: Home > Recombinant Protein > Recombinant Homo sapiens Protein S100-A7A

Recombinant Homo sapiens Protein S100-A7AAP73092

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Homo sapiens Protein S100-A7A
Brief Description Recombinant Protein
Host Species Yeast
Target Name S1A7A
Alternative Names S100 calcium-binding protein A15S100 calcium-binding protein A7-like 1S100 calcium-binding protein A7A
Accession No. Uniprot ID: Q86SG5
Target Species HUMAN
Calculated MW 13.17kD
Target Length Full length, 2-101aa
Tag Info His-tag
Target Sequence SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ
Formulation 20mM Tris-HCl based buffer,pH8.0
Storage Store at -20˚C, for extended storage, conserve at -20˚C or -80˚C. Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.