Your Position: Home > Recombinant Protein > Recombinant Mercurialis annua Profilin

Recombinant Mercurialis annua ProfilinAP73909

Catalog No.	Package Size	Price
AP73909-1	10ug	$105.00
AP73909-2	50ug	$260.00
AP73909-3	100ug	$454.00
AP73909-4	200ug	$735.00
AP73909-5	500ug	$1240.00
AP73909-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Mercurialis annua Profilin
Brief Description Recombinant Protein
Host Species E.coli
Alternative Names Pollen allergen Mer a 1 Allergen: Mer a 1
Accession No. Uniprot ID: O49894
Target Species Mercurialis annua (Annual mercury)
SDS-PAGE MW 30.29kDa
Target Length Full Length,1-133aa
Tag Info N-terminal 6xHis-SUMO-tagged
Target Sequence MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPGHLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIEQGM
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG

Regerences

"Characterization of recombinant Mercurialis annua major allergen Mer a 1 (profilin)."Vallverdu A., Asturias J.A., Arilla M.C., Gomez-Bayon N., Martinez A., Martinez J., Palacios R.J. Allergy Clin. Immunol. 101:363-370(1998)

Published Papers

let us know

Customer Reviews and Rankings

No comment