Your Position: Home > Recombinant Protein > Recombinant Pyrococcus furiosus DNA/RNA-binding protein Alba(albA)

Recombinant Pyrococcus furiosus DNA/RNA-binding protein Alba(albA)AP73908

Catalog No.	Package Size	Price
AP73908-1	10ug	$105.00
AP73908-2	50ug	$260.00
AP73908-3	100ug	$454.00
AP73908-4	200ug	$735.00
AP73908-5	500ug	$1240.00
AP73908-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Pyrococcus furiosus DNA/RNA-binding protein Alba(albA)
Brief Description Recombinant Protein
Host Species E.coli
Target Name albA
Accession No. Uniprot ID: Q8TZV1
Target Species Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422
SDS-PAGE MW 26.38kDa
Target Length Full Length,1-93aa
Tag Info N-terminal 6xHis-SUMO-tagged
Target Sequence MAEEHVVYIGKKPVMNYVLAVITQFNEGAKEVSIKARGRAISRAVDVAEIVRNRFLKDTVDIKEIKIGTEELPTADGRTTNTSTIEIVLERKV
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Regerences

"Divergence of the hyperthermophilic archaea Pyrococcus furiosus and P. horikoshii inferred from complete genomic sequences."Maeder D.L., Weiss R.B., Dunn D.M., Cherry J.L., Gonzalez J.M., DiRuggiero J., Robb F.T.Genetics 152:1299-1305(1999)

Published Papers

let us know

Customer Reviews and Rankings

No comment