Your Position: Home > Recombinant Protein > Recombinant Mouse Angiogenin-4(Ang4)

Recombinant Mouse Angiogenin-4(Ang4)AP73852

Catalog No.	Package Size	Price
AP73852-1	10ug	$105.00
AP73852-2	50ug	$260.00
AP73852-3	100ug	$454.00
AP73852-4	200ug	$735.00
AP73852-5	500ug	$1240.00
AP73852-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Mouse Angiogenin-4(Ang4)
Brief Description Recombinant Protein
Host Species Yeast
Target Name Ang4
Accession No. Uniprot ID: Q3TMQ6
Target Species Ms
SDS-PAGE MW 29.92kDa
Target Length Full Length,25-144aa
Tag Info N-terminal 6xHis-SUMO-tagged
Target Sequence QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts

Regerences

"Angiogenins: a new class of microbicidal proteins involved in innate immunity."Hooper L.V., Stappenbeck T.S., Hong C.V., Gordon J.I.Nat. Immunol. 4:269-273(2003)

Published Papers

let us know

Customer Reviews and Rankings

No comment