Your Position: Home > Recombinant Protein > Recombinant Mouse Complement receptor type 2(Cr2),partial

Recombinant Mouse Complement receptor type 2(Cr2),partialAP73851

Catalog No.	Package Size	Price
AP73851-1	10ug	$105.00
AP73851-2	50ug	$260.00
AP73851-3	100ug	$454.00
AP73851-4	200ug	$735.00
AP73851-5	500ug	$1240.00
AP73851-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Mouse Complement receptor type 2(Cr2),partial
Brief Description Recombinant Protein
Host Species Yeast
Target Name Cr2
Alternative Names Complement C3d receptor CD_antigen: CD21
Accession No. Uniprot ID: P19070
Target Species Ms
SDS-PAGE MW 27.99kDa
Target Length Partial,729-963aa
Tag Info N-terminal 6xHis-tagged
Target Sequence LYGNEVSYECDEGFYLLGEKSLQCVNDSKGHGSWSGPPPQCLQSSPLTHCPDPEVKHGYKLNKTHSAFSHNDIVHFVCNQGFIMNGSHLIRCHTNNTWLPGVPTCIRKASLGCQSPSTIPNGNHTGGSIARFPPGMSVMYSCYQGFLMAGEARLICTHEGTWSQPPPFCKEVNCSFPEDTNGIQKGFQPGKTYRFGATVTLECEDGYTLEGSPQSQCQDDSQWNPPLALCKYRRW
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

Receptor for complement C3d. Participates in B lymphocytes activation.

Regerences

"A molecular and immunochemical characterization of mouse CR2. Evidence for a single gene model of mouse complement receptors 1 and 2." Molina H., Kinoshita T., Inoue K., Carel J.-C., Holers V.M.J. Immunol. 145:2974-2983(1990)

Published Papers

let us know

Customer Reviews and Rankings

No comment