Your Position: Home > Recombinant Protein > Recombinant Human Apolipoprotein B-100(APOB),partial

Recombinant Human Apolipoprotein B-100(APOB),partialAP73845

Catalog No.	Package Size	Price
AP73845-1	10ug	$105.00
AP73845-2	50ug	$260.00
AP73845-3	100ug	$454.00
AP73845-4	200ug	$735.00
AP73845-5	500ug	$1240.00
AP73845-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Human Apolipoprotein B-100(APOB),partial
Brief Description Recombinant Protein
Host Species Yeast
Target Name APOB
Alternative Names Apolipoprotein B-48 Short name: Apo B-48
Accession No. Uniprot ID: P04114
Target Species Hu
SDS-PAGE MW 13.19kDa
Target Length Partial,28-127aa
Tag Info N-terminal 6xHis-tagged
Target Sequence EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor.

Regerences

"Complete cDNA and derived protein sequence of human apolipoprotein B-100."Knott T.C., Wallis S.C., Powell L.M., Pease R.J., Lusis A.J., Blackhart B., McCarthy B.J., Mahley R.W., Levy-Wilson B., Scott J.Nucleic Acids Res. 14:7501-7503(1986)

Published Papers

let us know

Customer Reviews and Rankings

No comment