Your Position: Home > Recombinant Protein > Recombinant Xenopus laevis Transforming growth factor beta-1(tgfb1)

Recombinant Xenopus laevis Transforming growth factor beta-1(tgfb1)AP73842

Catalog No.	Package Size	Price
AP73842-1	10ug	$105.00
AP73842-2	50ug	$260.00
AP73842-3	100ug	$454.00
AP73842-4	200ug	$735.00
AP73842-5	500ug	$1240.00
AP73842-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Xenopus laevis Transforming growth factor beta-1(tgfb1)
Brief Description Recombinant Protein
Host Species E.coli
Target Name tgfb1
Alternative Names Short name: TGF-beta-1 Alternative name(s): TGF-beta-5
Accession No. Uniprot ID: P16176
Target Species Xenopus laevis (African clawed frog)
SDS-PAGE MW 28.63kDa
Target Length Full Length,271-382aa
Tag Info N-terminal 6xHis-SUMO-tagged
Target Sequence GVGQEYCFGNNGPNCCVKPLYINFRKDLGWKWIHEPKGYEANYCLGNCPYIWSMDTQYSKVLSLYNQNNPGASISPCCVPDVLEPLPIIYYVGRTAKVEQLSNMVVRSCNCS
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

Important role in certain aspects of differentiation.

Regerences

"Identification of a novel transforming growth factor-beta (TGF-beta 5) mRNA in Xenopus laevis."Kondaiah P., Sands M.J., Smith J.M., Fields A., Roberts A.B., Sporn M.B., Melton D.A.J. Biol. Chem. 265:1089-1093(1990)

Published Papers

let us know

Customer Reviews and Rankings

No comment