Your Position: Home > Recombinant Protein > Recombinant Human Estrogen receptor beta(ESR2),partial

Recombinant Human Estrogen receptor beta(ESR2),partialAP73841

Catalog No.	Package Size	Price
AP73841-1	10ug	$105.00
AP73841-2	50ug	$260.00
AP73841-3	100ug	$454.00
AP73841-4	200ug	$735.00
AP73841-5	500ug	$1240.00
AP73841-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Human Estrogen receptor beta(ESR2),partial
Brief Description Recombinant Protein
Host Species E.coli
Target Name ESR2
Alternative Names Short name: ER-beta Alternative name(s): Nuclear receptor subfamily 3 group A member 2
Accession No. Uniprot ID: Q92731
Target Species Hu
SDS-PAGE MW 51.79kDa
Target Length Partial,2-323AA
Tag Info N-terminal 6xHis-SUMO-tagged
Target Sequence DIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGFVELS
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

Nuclear hormone receptor. Binds estrogens with an affinity similar to that of ESR1, and activates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependent manner (PubMed:20074560). Isoform beta-cx lacks ligand binding ability and has no or only very low ere binding activity resulting in the loss of ligand-dependent transactivation ability. DNA-binding by ESR1 and ESR2 is rapidly lost at 37 degrees Celsius in the absence of ligand while in the presence of 17 beta-estradiol and 4-hydroxy-tamoxifen loss in DNA-binding at elevated temperature is more gradual.

Regerences

"Repression of estrogen receptor beta function by putative tumor suppressor DBC1."Koyama S., Wada-Hiraike O., Nakagawa S., Tanikawa M., Hiraike H., Miyamoto Y., Sone K., Oda K., Fukuhara H., Nakagawa K., Kato S., Yano T., Taketani Y.Biochem. Biophys. Res. Commun. 392:357-362(2010)

Published Papers

let us know

Customer Reviews and Rankings

No comment