Your Position: Home > Recombinant Protein > Recombinant Woodchuck hepatitis B virus Protein X(X)

Recombinant Woodchuck hepatitis B virus Protein X(X)AP73834

Catalog No.	Package Size	Price
AP73834-1	10ug	$105.00
AP73834-2	50ug	$260.00
AP73834-3	100ug	$454.00
AP73834-4	200ug	$735.00
AP73834-5	500ug	$1240.00
AP73834-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Woodchuck hepatitis B virus Protein X(X)
Brief Description Recombinant Protein
Host Species E.coli
Target Name X
Alternative Names HBx Peptide X pX
Accession No. Uniprot ID: P17401
Target Species Woodchuck hepatitis B virus (isolate 8) (WHV)
SDS-PAGE MW 19.32kDa
Target Length Full Length,1-141aa
Tag Info N-terminal 6xHis-tagged
Target Sequence MAARLCCHLDSARDVLLLRPFGPQSSGPSFPRPAAGSAASSASSPSPSDESDLPLGRLPACFASASGPCCLVFTCADLRTMDSTVNFVSWHANRQLGMPSKDLWTPYIKDQLLTKWEEGSIDPRLSIFVLGGCRHKCMRLL
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

Multifunctional protein that may modulate protein degradation pathways, apoptosis, transcription, signal transduction, cell cycle progress, and genetic stability by directly or indirectly interacting with hosts factors. Does not seem to be essential for HBV infection. May be directly involved in development of cirrhosis and liver cancer (hepatocellular carcinoma). Most of cytosolic activities involve modulation of cytosolic calcium. Effect on apoptosis is controversial depending on the cell types in which the studies have been conducted

Regerences

"Complete nucleotide sequence of a molecular clone of woodchuck hepatitis virus that is infectious in the natural host."Girones R., Cote P.J., Hornbuckle W.E., Tennant B.C., Gerin J.L., Purcell R.H., Miller R.H.Proc. Natl. Acad. Sci. U.S.A. 86:1846-1849(1989)

Published Papers

let us know

Customer Reviews and Rankings

No comment