Your Position: Home > Recombinant Protein > Recombinant Pig Beta-nerve growth factor(NGF)

Recombinant Pig Beta-nerve growth factor(NGF)AP73754

Catalog No.	Package Size	Price
AP73754-1	10ug	$105.00
AP73754-2	50ug	$260.00
AP73754-3	100ug	$454.00
AP73754-4	200ug	$735.00
AP73754-5	500ug	$1240.00
AP73754-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Pig Beta-nerve growth factor(NGF)
Brief Description Recombinant Protein
Host Species E.coli
Target Name NGF
Alternative Names Beta-NGF
Accession No. Uniprot ID: Q29074
Target Species Sus scrofa (Pig)
SDS-PAGE MW 29.43kDa
Target Length Full Length,110-229aa
Tag Info N-terminal 6xHis-SUMO-tagged
Target Sequence SSSHPVFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAGRRA
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular domain ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI.

Regerences

"A new marker (NGFB) on pig chromosome 4, isolated by using a consensus sequence conserved among species."Lahbib-Mansais Y., Mellink C., Yerle M., Gellin J.Cytogenet. Cell Genet. 67:120-125(1994)

Published Papers

let us know

Customer Reviews and Rankings

No comment