Your Position: Home > Recombinant Protein > Recombinant Human Fractalkine(CX3CL1),partial

Recombinant Human Fractalkine(CX3CL1),partialAP73674

Catalog No.	Package Size	Price
AP73674-1	10ug	$105.00
AP73674-2	50ug	$260.00
AP73674-3	100ug	$454.00
AP73674-4	200ug	$735.00
AP73674-5	500ug	$1240.00
AP73674-6	1mg	$1980.00

Quantity: Total:

Review：

Availability: The lead time is currently 7-30 days.

Description

Product Name Recombinant Human Fractalkine(CX3CL1),partial
Brief Description Recombinant Protein
Host Species E.coli
Target Name CX3CL1
Alternative Names C-X3-C motif chemokine 1CX3C membrane-anchored chemokineNeurotactin;Small-inducible cytokine D1
Accession No. Uniprot ID: P78423
Target Species Hu
SDS-PAGE MW 31.20kDa
Target Length Partial,25-100aa
Tag Info N-terminal 25xHis-SUMO-tagged
Target Sequence QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG
Formulation Tris-based buffer,50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C/-80˚C. The shelf life of lyophilized form is 12 months at -20˚C/-80˚C.

Application Details

Greater than 90% as determined by SDS-PAGE.

Images

Background

The soluble form is chotactic for T-cells and monocytes, but not for neutrophils. The mbrane-bound form promotes adhesion of those leukocytes to endothelial cells. May play a role in regulating leukocyte adhesion and migration processes at the endothelium. Binds to CX3CR1.

Regerences

Structural basis of chemokine sequestration by CrmD, a poxvirus-encoded tumor necrosis factor receptor.Xue X., Lu Q., Wei H., Wang D., Chen D., He G., Huang L., Wang H., Wang X.PLoS Pathog. 7:E1002162-E1002162(2011)

Published Papers

let us know

Customer Reviews and Rankings

No comment